PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G38180.1
Common NameLOC102708494
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 327aa    MW: 35701.1 Da    PI: 4.3791
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G38180.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17e-1976129356
                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   k++++t+eq++ Le+ Fe+++++  e+++eLA+klgL+ rqV vWFq rRa++k
  OB02G38180.1  76 KKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQSRRARWK 129
                   5678*************************************************9 PP

2HD-ZIP_I/II128.13.6e-4175167193
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                   ekkrrl+ eqv+lLE+sFeee+kLeperK+elar+LglqprqvavWFq rRAR+ktkqlE+d+++Lk+++dal++++++L +++++L++++++
  OB02G38180.1  75 EKKRRLTPEQVHLLERSFEEENKLEPERKTELARKLGLQPRQVAVWFQSRRARWKTKQLERDFARLKASFDALRADHDALLQDNNRLHSQVMS 167
                   69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.78E-1970133IPR009057Homeodomain-like
PROSITE profilePS5007117.5471131IPR001356Homeobox domain
SMARTSM003893.0E-1874135IPR001356Homeobox domain
CDDcd000866.96E-1976132No hitNo description
PfamPF000463.9E-1676129IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.3E-2077136IPR009057Homeodomain-like
PRINTSPR000311.2E-5102111IPR000047Helix-turn-helix motif
PRINTSPR000311.2E-5111127IPR000047Helix-turn-helix motif
PfamPF021835.6E-18131173IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MESGRLIFST AGSGAGQMLF LDCGAGGGAG GGAMFHRGAR PVLGMDEGGR GVKRPFFTTP  60
DELLEEEYYD EQLPEKKRRL TPEQVHLLER SFEEENKLEP ERKTELARKL GLQPRQVAVW  120
FQSRRARWKT KQLERDFARL KASFDALRAD HDALLQDNNR LHSQVMSLTE KLQEKEASEG  180
SAGAAVDASG LPAADVKVAV ADAEEQAPAE AVFEVQQVKA EDRVSTGSGG SAVEDADTLL  240
GCGRQLAAVD SSVESYFPGD EYHDCVMGPM DHAAAGIQSE EDDGAGSDEG CSYYADDAGV  300
LFADHNHHHH ADDDEEDGSQ ISWWMWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123131RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8331530.0CT833153.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI226L23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647837.10.0PREDICTED: homeobox-leucine zipper protein HOX16 isoform X1
SwissprotQ6YWR41e-169HOX16_ORYSJ; Homeobox-leucine zipper protein HOX16
TrEMBLJ3LGQ10.0J3LGQ1_ORYBR; Uncharacterized protein
STRINGOB02G38180.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26093887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.16e-61homeobox 1